Skip to product information
1 of 1

Semaglutide

Semaglutide

Regular price $130.00 USD
Regular price Sale price $130.00 USD
Sale Sold out
Shipping calculated at checkout.
Volume
Quantity

CAS Number: 910463-68-2
Molecular Formula: C<sub>187</sub>H<sub>291</sub>N<sub>45</sub>O<sub>59</sub>
Molecular Weight: 4113.58 g/mol
Sequence: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG–E (with modifications for stability and activity)

___________________________

Semaglutide is a long-acting glucagon-like peptide-1 (GLP-1) receptor agonist, originally developed through structural modifications of the native GLP-1 molecule. These modifications include the substitution of amino acid residues and the addition of a C-18 fatty diacid chain via a spacer at position 26, which significantly enhances plasma stability and extends half-life, making it suitable for once-weekly administration in clinical settings.

____________________________

Research Applications

Semaglutide is widely studied in metabolic and endocrinological research, with a primary focus on:

Glycemic Control: Investigating its effects on insulin secretion, glucagon suppression, and delayed gastric emptying.

Appetite Regulation: Evaluating central nervous system impacts on satiety and food intake.

Weight Management: Exploring its role in body composition modulation in metabolic disease models.

Cardiometabolic Health: Studying potential cardiovascular benefits and inflammatory biomarker response.

This compound has demonstrated high binding affinity to GLP-1 receptors and has been extensively evaluated in both in vivo and in vitro models.

_____________________________

For Research Use Only

Semaglutide offered by PeptideStock.com is strictly intended for qualified research professionals and institutions. This product is not for human consumption, medical, or veterinary use. Proper handling protocols and storage procedures are required.

View full details